Skip to main content

Table 1 Summary of antibodies tested on Western Blot

From: Dynamic and redundant regulation of LRRK2 and LRRK1 expression

Antibody Overexpressed mLRRK2 Overexpressed hLRRK2 Endogenous mLRRK2 Endogenous hLRRK2 Peptide Location
Abgent AP7099a - - - - N/A
Abgent AP7099b - - - - (LRR, AA 1246–1265, 100% identity)
H: WSRVEKLHLSHNKLKEIPPE
M: WSRVEKLHLSHNKLKEIPPE
Abgent AP7099c - - - - (N-Term, around L229)
H: EEIVLHVLHCLHSLAIPCNNVEVLMSGNVR
M: KEIVYHVLCCLHSLAVTCSNVEVLMSGNVR
Abgent AP7099d - - - - (N-Term, around E285)
H: VSCCLLHRLTLGNFFNILVLNEVHEFVVKA
M: VSCSLFQKLTLGNFFNILVLNEVHVFVVKA
Abgent AP7099e - + - + (N-Term, around E519)
H: RAILHFIVPGMPEESREDTEFHHKLNMVKK
M: RAILHFVVPGLLEESRE..DSQCRPNVLRK
Abgent AP7099f - + - - (N-Term, around L893)
H: AQSDDLDSEGSEGSFLVKKKSNSISVGEFY
M: GQSDDLDSEGSESSFLVKRKSNSISVGEVY
Abgent AP7099g - + - - (N-Term, around L899)
H: AQSDDLDSEGSEGSFLVKKKSNSISVGEFY
M: GQSDDLDSEGSESSFLVKRKSNSISVGEVY
Abgent AP7099h - + - - (N-Term, around L955)
H: IFDHEDLLKRKRKILSSDDSLRSSKLQSHM
M: VFDHEDLLRRKRKILSSDESLRSSRLPSHM
Abgent AP7099i - - - - (C-Term, around C2354)
H: STERNVMWGGCGTKIFSFSNDFTIQKLIET
M: SSERHITWGGCGTKVFSFSNDFTIQKLIET
Abgent AP7099j - - - - (C-Term, around K2402)
H: CVHFLREVMVKENKESKHKMSYSGRVKTLC
M: CVHFLKEVMVKLNKESKHQLSYSGRVKALC
Abgent AP7099k - - - - (C-Term, around Y2475)
H: MTAQLGSLKNVMLVLGYNRKNTEGTQKQKE
M: ATAQLGSLKNVMLVLGYKRKSTEGIQEQKE
Abgent AM7099a - - - - (monoclonal) N/A
Abgent AM7099b - - - - (monoclonal) N/A
Abcam 27482 - + - - N/A
Abcam 19906 - - - - N/A
Novus Biological 267 - + - + (N-Term, AA 920–945)
H: SNSISVGEFYRDAVLQRCSPNLQRHS
M: SNSISVGEVYRDLALQRYSPNAQRHS
Novus Biological 268 - + - + (C-Term, AA 2500–2527)
H: INLPHEVQNLEKHIEVRKELAEKMRRTSVE
M: LNLPHEVQNLEKHIEVRTELADKMRKTSVE
Chemicon AB9682 - + - - N/A, synthetic peptide from rat
Chemicon AB9704 - + - - N/A
Alexis (AT106) + + + + (AA 1838–2133)
Cell Signaling 2567 + + - - (C-Term, G2090)
H: FPNEFDELEIQGKLPDPVKEYGCAPWPMVE
M: FPNEFDELAIQGKLPDPVKEYGCAPWPMVE
JH5514 + + + + (C-Term, AA 2500–2515), 100% identity
H: INLPHEVQNLEKHIE
M: LNLPHEVQNLEKHIE
  1. Summary of the results of commercially available antibodies against LRRK2 tested on Western Blot. A (+) denotes antibodies that produce a discernable band specific to LRRK2 protein. A (-) denotes antibodies unable to detect a band specific to LRRK2 protein. Antibodies were designed against the human sequence unless otherwise indicated.