Antibody | Manufacturer | Product number | RRID | Application/Conc. | Antigen sequences | References | PMID |
---|---|---|---|---|---|---|---|
Aromatase | Novus Biologicals LLC, Centennial CO, US | NB100-1596 | AB_10000919 | WB; 1:2000 (0.5 μL/mL) | Human Aromatase protein (between residues 400-502). [UniProt# P11511] | Giles et al., Breast Cancer Res. 2018; 20(1): 50 | 29898754 |
Neuronal Nitric oxide synthase (nNOS) | Novus Biologicals | NBP1-39681 | AB_2282822 | WB; 1:1500 (0.75 μL/mL) | Human nNOS amino acids 1422-1433 (ESKKDTDEVFSS) | Mahmood et al., Mol. Cell. Neurosci. 2019; 95: 51-58 | 30660767 |
Glutamate Decarboxylase 65/67 (GAD) | Millipore Sigma, Burlington, MA, US | ABN904 | Not available | WB; 1:10000 (0.1 μL/mL) | KLH-conjugated linear peptide corresponding to 14 amino acids from the C-terminal region of human glutamate decarboxylase 2 (GAD2). | Ibrahim, et al., Brain Res. 2019; 1711: 48-57 | 30629946 |
Glycogen Phosphorylase-Brain Type (GPbb) | Novus Biologicals | NBP1-32799 | AB_2253353 | WB; 1:2000 (0.5 μL/mL) | Recombinant protein encompassing a sequence within the C-terminus region of human GPBB. The exact sequence is proprietary | Ali MH et al.; Neuroscience 2019; 409: 253-260 | 30954669 |
Glycogen Phosphorylase-Muscle Type (GPmm) | Novus Biologicals | NBP2-16689 | Not available | WB; 1:2000 (0.5 μL/mL) | Recombinant protein encompassing a sequence within the center region of human PYGM. The exact sequence is proprietary | Ali MH et al.; Neuroscience 2019; 409: 253-260 | 30954669 |
Glycogen Synthase (GS) | Cell Signaling Technology LLC, Danvers CT, US | 3893S | AB_2279563 | WB; 1:2000 (0.5 μL/mL) | Antibody detects total muscle glycogen synthase protein | Ibrahim et al., Brain Res. 2019; 1711: 48-57 | 30629946 |
Glutaminase (GLT) | Novus Biologicals | NBP1-89766 | AB_11013964 | WB; 1:1500 (0.75 μL/mL | DRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGL | Uddin et al., Brain Res. 2019; 1720: 146311 | 31265816 |
Malic Enzyme 1 (ME1) | Novus Biologicals | NBP1-32398 | AB_2143825 | WB; 1:2000 (0.5 μL/mL) | Recombinant protein encompassing a sequence within the center region of human ME1. The exact sequence is proprietary | Uddin et al., Brain Res. 2019; 1720: 146311 | 31265816 |